Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00025855-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00025855-M01, RRID:AB_464177
- Product name
- BRMS1 monoclonal antibody (M01), clone 2D4-2G11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant BRMS1.
- Antigen sequence
MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERS
GSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQ
FSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPL
GGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQG
AKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLD
LSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSG
PYIVYMLQEIDILEDWTAIKKARAAVSPQKRKSDG
P- Isotype
- IgG
- Antibody clone number
- 2D4-2G11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression of the metastasis suppressor BRMS1 in uveal melanoma.
BRMS1 suppresses lung cancer metastases through an E3 ligase function on histone acetyltransferase p300.
Low BRMS1 expression promotes nasopharyngeal carcinoma metastasis in vitro and in vivo and is associated with poor patient survival.
Breast cancer metastasis suppressor 1 (BRMS1) is destabilized by the Cul3-SPOP E3 ubiquitin ligase complex.
Breast cancer metastasis suppressor 1 (BRMS1) suppresses metastasis and correlates with improved patient survival in non-small cell lung cancer.
Proteomics-based strategy to delineate the molecular mechanisms of the metastasis suppressor gene BRMS1.
Breast cancer metastasis suppressor 1 functions as a corepressor by enhancing histone deacetylase 1-mediated deacetylation of RelA/p65 and promoting apoptosis.
Ventura BV, Quezada C, Maloney SC, Fernandes BF, Antecka E, Martins C, Bakalian S, di Cesare S, Burnier MN Jr
Ecancermedicalscience 2014;8:410
Ecancermedicalscience 2014;8:410
BRMS1 suppresses lung cancer metastases through an E3 ligase function on histone acetyltransferase p300.
Liu Y, Mayo MW, Nagji AS, Hall EH, Shock LS, Xiao A, Stelow EB, Jones DR
Cancer research 2013 Feb 15;73(4):1308-17
Cancer research 2013 Feb 15;73(4):1308-17
Low BRMS1 expression promotes nasopharyngeal carcinoma metastasis in vitro and in vivo and is associated with poor patient survival.
Cui RX, Liu N, He QM, Li WF, Huang BJ, Sun Y, Tang LL, Chen M, Jiang N, Chen L, Yun JP, Zeng J, Guo Y, Wang HY, Ma J
BMC cancer 2012 Aug 29;12:376
BMC cancer 2012 Aug 29;12:376
Breast cancer metastasis suppressor 1 (BRMS1) is destabilized by the Cul3-SPOP E3 ubiquitin ligase complex.
Kim B, Nam HJ, Pyo KE, Jang MJ, Kim IS, Kim D, Boo K, Lee SH, Yoon JB, Baek SH, Kim JH
Biochemical and biophysical research communications 2011 Dec 2;415(4):720-6
Biochemical and biophysical research communications 2011 Dec 2;415(4):720-6
Breast cancer metastasis suppressor 1 (BRMS1) suppresses metastasis and correlates with improved patient survival in non-small cell lung cancer.
Smith PW, Liu Y, Siefert SA, Moskaluk CA, Petroni GR, Jones DR
Cancer letters 2009 Apr 18;276(2):196-203
Cancer letters 2009 Apr 18;276(2):196-203
Proteomics-based strategy to delineate the molecular mechanisms of the metastasis suppressor gene BRMS1.
Rivera J, Megias D, Bravo J
Journal of proteome research 2007 Oct;6(10):4006-18
Journal of proteome research 2007 Oct;6(10):4006-18
Breast cancer metastasis suppressor 1 functions as a corepressor by enhancing histone deacetylase 1-mediated deacetylation of RelA/p65 and promoting apoptosis.
Liu Y, Smith PW, Jones DR
Molecular and cellular biology 2006 Dec;26(23):8683-96
Molecular and cellular biology 2006 Dec;26(23):8683-96
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of BRMS1 expression in transfected 293T cell line by BRMS1 monoclonal antibody (M01), clone 2D4-2G11.Lane 1: BRMS1 transfected lysate (Predicted MW: 28.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged BRMS1 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of BRMS1 transfected lysate using anti-BRMS1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with BRMS1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol