HPA019637

BRMS1 antibody from Sigma-Aldrich
DKFZP564A063
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019637
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019637, RRID:AB_1845448
Product name
Anti-BRMS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019637
Antibody type
Polyclonal
Antigen
Breast cancer metastasis-suppressor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDD
KLHARGSSRSWDSLPPSKRKKAPLVSGPYIVYMLQ
EIDILEDWTAIKKARAAVSPQK
Storage
-20C
Provider Type Product Number
- No reagents -