Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1545521 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Fas Ligand (TNF Superfamily, Member 6) (FASL) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FASLG antibody: synthetic peptide directed towards the middle region of human FASLG
- Description
- Protein A purified
- Reactivity
- Human, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNS
RSMPL EWEDTYGIVL- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Fas ligand mediates activation-induced cell death in human T lymphocytes.
Alderson MR, Tough TW, Davis-Smith T, Braddy S, Falk B, Schooley KA, Goodwin RG, Smith CA, Ramsdell F, Lynch DH
The Journal of experimental medicine 1995 Jan 1;181(1):71-7
The Journal of experimental medicine 1995 Jan 1;181(1):71-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: TNFSF6 Sample Tissue: Hela Cell Antibody Dilution: 1.0 μg/mL