H00000356-D01P

FASLG antibody from Abnova Corporation
APT1LG1, CD178, FasL, TNFSF6

Antibody data

Product number
H00000356-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000356-D01P, RRID:AB_1573490
Product name
FASLG purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00000356-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human FASLG protein.
Antigen sequence
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTS
VPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPP
LKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLF
HLQKELAELRESTSQMHTASSLEKQIGHPSPPPEK
KELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVK
YKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHK
VYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYL
GAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYK
L
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -