HPA035832

antibody from Atlas Antibodies

Targeting: CD33 FLJ00391, p67, SIGLEC-3, SIGLEC3

Antibody data

Submit

Validation data

Product number: HPA035832 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA035832, RRID:AB_2674808
Product name: Anti-CD33
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLH GPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSK DTSTEYSEVRTQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CD33 protein structure - HPA035832 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lung and skeletal muscle tissues using HPA035832 antibody. Corresponding CD33 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows membranous and cytoplasmic positivity in germinal center cells and non-germinal center cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows moderate positivity in macrophages.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows moderate positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN