HPA018502

MTMR1 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018502
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018502, RRID:AB_1854185
Product name
Anti-MTMR1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018502
Antibody type
Polyclonal
Antigen
Myotubularin-related protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GRRPPRAAGGATAGSRQPSVETLDSPTGSHVEWCK
QLIAATISSQISGSVTSENVSRDYKALRDGNKLAQ
MEEAPLFPGESIKAIVKDVMYICPFMGAVSGTLTV
TDFKLYFKNVERDPH
Storage
-20C
Provider Type Product Number
- No reagents -