Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007364-M02 - Provider product page

- Provider
- Abnova Corporation
- Product name
- UGT2B7 monoclonal antibody (M02), clone 8D12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UGT2B7.
- Antigen sequence
SSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKD
TFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMK
KVQESRFDVIFADAIFPCS- Isotype
- IgG
- Antibody clone number
- 8D12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of UGT2B7 expression in transfected 293T cell line by UGT2B7 monoclonal antibody (M02), clone 8D12.Lane 1: UGT2B7 transfected lysate (Predicted MW: 58.19 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UGT2B7 monoclonal antibody (M02), clone 8D12. Western Blot analysis of UGT2B7 expression in PC-12.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UGT2B7 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol