Antibody data

Product number
HPA041004
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041004, RRID:AB_10794433
Product name
Anti-SLC9A5
Provider product page
Atlas Antibodies - HPA041004
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ASPPCNQAPILTCLPPHPRGTEEPQVPLHLPSDPR
SSFAFPPSLAKAGRSRSESSADLPQQQELQPLMGH
KDHTHL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.