HPA019163

CCL2 antibody from Atlas Antibodies
GDCF-2, HC11, MCAF, MCP-1, MCP1, MGC9434, SCYA2, SMC-CF
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019163
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019163, RRID:AB_1846179
Product name
Anti-CCL2
Provider product page
Atlas Antibodies - HPA019163
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PDAINAPVTCCYNFTNRKISVQRLASYRRITSSKC
PKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQT
QTPKT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -