Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405477 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Gasdermin B (GSDMB) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GSDML antibody: synthetic peptide directed towards the N terminal of human GSDML
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
HLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDE
LDSGL QGQKAEFQIL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Strabismus surgery for internuclear ophthalmoplegia with exotropia in multiple sclerosis.
Adams WE, Leavitt JA, Holmes JM
Journal of AAPOS : the official publication of the American Association for Pediatric Ophthalmology and Strabismus / American Association for Pediatric Ophthalmology and Strabismus 2009 Feb;13(1):13-5
Journal of AAPOS : the official publication of the American Association for Pediatric Ophthalmology and Strabismus / American Association for Pediatric Ophthalmology and Strabismus 2009 Feb;13(1):13-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting