HPA023925

GSDMB antibody from Sigma-Aldrich
GSDML, PRO2521
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023925
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023925, RRID:AB_1850383
Product name
Anti-GSDMB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023925
Antibody type
Polyclonal
Antigen
Gasdermin-B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGGDMIAVRSLVDADRFRCFHLVGEKRTFFGCRHY
TTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQIL
DNVDSTGELIVRLPKEIT
Storage
-20C
Provider Type Product Number
- No reagents -