HPA001583

ATP2B3 antibody from Sigma-Aldrich
CFAP39, CLA2, PMCA3, SCAX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001583
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001583, RRID:AB_1079641
Product name
Anti-ATP2B3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001583
Antibody type
Polyclonal
Antigen
Plasma membrane calcium-transporting ATPase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IRVVKAFRSSLYEGLEKPESKTSIHNFMATPEFLI
NDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNN
AIDSGIYLTTHVTKSATSSVFSSSPGSPLHSVETS
Storage
-20C
Provider Type Product Number
- No reagents -