HPA019697

PSIP1 antibody from Atlas Antibodies
DFS70, LEDGF, p52, p75, PSIP2
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA019697
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019697, RRID:AB_1852779
Product name
Anti-PSIP1
Provider product page
Atlas Antibodies - HPA019697
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVK
IPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEE
KQPKKQPKKDEEGQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -