Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011168-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011168-M01, RRID:AB_463777
- Product name
- PSIP1 monoclonal antibody (M01), clone 3H1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PSIP1.
- Antigen sequence
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKP
PTNKLPIFFFGTHET- Isotype
- IgG
- Antibody clone number
- 3H1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references LEDGF/p75 functions downstream from preintegration complex formation to effect gene-specific HIV-1 integration.
Shun MC, Raghavendra NK, Vandegraaff N, Daigle JE, Hughes S, Kellam P, Cherepanov P, Engelman A
Genes & development 2007 Jul 15;21(14):1767-78
Genes & development 2007 Jul 15;21(14):1767-78
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PSIP1 monoclonal antibody (M01), clone 3H1. Western Blot analysis of PSIP1 expression in human liver.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PSIP1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to PSIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol