Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011168-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011168-M02, RRID:AB_1579254
- Product name
- PSIP1 monoclonal antibody (M02), clone 1C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant PSIP1.
- Antigen sequence
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKP
PTNKLPIFFFGTHET- Isotype
- IgG
- Antibody clone number
- 1C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PSIP1 monoclonal antibody (M02), clone 1C4. Western Blot analysis of PSIP1 expression in human kidney.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PSIP1 monoclonal antibody (M02), clone 1C4. Western Blot analysis of PSIP1 expression in Hela S3 NE(Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PSIP1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol