HPA019697

PSIP1 antibody from MilliporeSigma / Merck KGaA
DFS70, LEDGF, p52, p75, PSIP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019697
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019697, RRID:AB_1852779
Product name
Anti-PSIP1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019697
Antibody type
Polyclonal
Antigen
PC4 and SFRS1-interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVK
IPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEE
KQPKKQPKKDEEGQ
Storage
-20C
Provider Type Product Number
- No reagents -