HPA005552

ACSL4 antibody from Sigma-Aldrich
ACS4, FACL4, LACS4, MRX63, MRX68
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005552
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005552, RRID:AB_1078774
Product name
Anti-ACSL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005552
Antibody type
Polyclonal
Antigen
Long-chain-fatty-acid-CoA ligase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MNYLEVNRRVNNFGSGLTALGLKPKNTIAIFCETR
AEWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNE
SEASYLITSVELLESKLKTALLDISCVKHIIYVDN
KAINKAEYPEGFEIHSMQSVEELGSNPENLGIPPS
RPTPSDMAIV
Storage
-20C
Provider Type Product Number
- No reagents -