HPA023143

DDHD2 antibody from Atlas Antibodies
KIAA0725, SAMWD1, SPG54
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023143
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023143, RRID:AB_1847534
Product name
Anti-DDHD2
Provider product page
Atlas Antibodies - HPA023143
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDKDNKYVPYSESFSQVLEETYMLAVTLDEWKKKL
ESPNREIIILHNPKLMVHYQPVAGSDDWGSTPTEQ
GRPRTV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -