HPA023143

DDHD2 antibody from Sigma-Aldrich
KIAA0725, SAMWD1, SPG54
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023143
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023143, RRID:AB_1847534
Product name
Anti-DDHD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023143
Antibody type
Polyclonal
Antigen
Phospholipase DDHD2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDKDNKYVPYSESFSQVLEETYMLAVTLDEWKKKL
ESPNREIIILHNPKLMVHYQPVAGSDDWGSTPTEQ
GRPRTV
Storage
-20C
Provider Type Product Number
- No reagents -