HPA002718

FTSJ1 antibody from Sigma-Aldrich
CDLIV, JM23, MRX44, MRX9, SPB1, TRM7, TRMT7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002718
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002718, RRID:AB_1078914
Product name
Anti-FTSJ1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002718
Antibody type
Polyclonal
Antigen
Putative ribosomal RNA methyltransferase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEG
GSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIR
PQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMS
CSP
Storage
-20C
Provider Type Product Number
- No reagents -