HPA017017

LTA4H antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017017
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017017, RRID:AB_1852818
Product name
Anti-LTA4H antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017017
Antibody type
Polyclonal
Antigen
Leukotriene A-4 hydrolase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YLERHICGRLFGEKFRHFNALGGWGELQNSVKTFG
ETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFY
LEQLLGGPEIFLGFLKAYVEKFSYKSITTDDWKDF
LYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDM
TL
Storage
-20C
Provider Type Product Number
- No reagents -