Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406761 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-DEK Oncogene (DEK) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DEK antibody: synthetic peptide directed towards the middle region of human DEK
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
ELKETIKKLLASANLEEVTMKQICKKVYENYPTYD
LTERK DFIKTTVKEL- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Galactose-poly(ethylene glycol)-polyethylenimine for improved lung gene transfer.
DEK overexpression in uterine cervical cancers.
Chen J, Gao X, Hu K, Pang Z, Cai J, Li J, Wu H, Jiang X
Biochemical and biophysical research communications 2008 Oct 24;375(3):378-83
Biochemical and biophysical research communications 2008 Oct 24;375(3):378-83
DEK overexpression in uterine cervical cancers.
Wu Q, Li Z, Lin H, Han L, Liu S, Lin Z
Pathology international 2008 Jun;58(6):378-82
Pathology international 2008 Jun;58(6):378-82
No comments: Submit comment
No validations: Submit validation data