HPA023646

PLPBP antibody from Atlas Antibodies
PROSC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023646
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023646, RRID:AB_1855741
Product name
Anti-PROSC
Provider product page
Atlas Antibodies - HPA023646
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VPNLFMLETVDSVKLADKVNSSWQRKGSPERLKVM
VQINTSGEESKHGLPPSETIAIVEHINAKCPNLEF
VGLMT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -