HPA024010

RAB11FIP1 antibody from Atlas Antibodies
FLJ22524, FLJ22622, Rab11-FIP1, RCP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024010
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024010, RRID:AB_1855991
Product name
Anti-RAB11FIP1
Provider product page
Atlas Antibodies - HPA024010
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ASVPSIDSMMRKLEEMGLNLRKDQKKTKKRVSFSE
QLFTEEAVAGAALLVEGHSSCPQELNPAWSVAG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -