HPA024010

RAB11FIP1 antibody from Sigma-Aldrich
FLJ22524, FLJ22622, Rab11-FIP1, RCP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024010
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024010, RRID:AB_1855991
Product name
Anti-RAB11FIP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024010
Antibody type
Polyclonal
Antigen
Rab11 family-interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASVPSIDSMMRKLEEMGLNLRKDQKKTKKRVSFSE
QLFTEEAVAGAALLVEGHSSCPQELNPAWSVAG
Storage
-20C
Provider Type Product Number
- No reagents -