Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406065 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ELOVL Fatty Acid Elongase 5 (ELOVL5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTF
ICSVI YLLIVWLGPK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mutation screening of three candidate genes, ELOVL5, SMAP1 and GLULD1 in autosomal recessive retinitis pigmentosa.
Barragan I, Marcos I, Borrego S, AntiƱolo G
International journal of molecular medicine 2005 Dec;16(6):1163-7
International journal of molecular medicine 2005 Dec;16(6):1163-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: ELOVL5 Sample Tissue: Human Fetal Heart Antibody Dilution: 1.0 μg/mL