HPA023594

CTBS antibody from Sigma-Aldrich
CTB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023594
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023594, RRID:AB_1847311
Product name
Anti-CTBS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023594
Antibody type
Polyclonal
Antigen
Di-N-acetylchitobiase Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSLKDIIDPAFRASWIAQKLNLAKTQYMDGINIDI
EQEVNCLSPEYDALTALVKETTDSFHREIEGSQVT
FDVAWSPKNIDRRCYNYTGIADACDFLFV
Storage
-20C
Provider Type Product Number
- No reagents -