Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486902 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Wingless-Type MMTV Integration Site Family Member 2 (WNT2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-WNT2 antibody: synthetic peptide directed towards the middle region of human WNT2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKER
KGKDA RALMNLHNNR- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression of seven gastric cancer-associated genes and its relevance for Wnt, NF-kappaB and Stat3 signaling.
Han JC, Zhang KL, Chen XY, Jiang HF, Kong QY, Sun Y, Wu ML, Huang L, Li H, Liu J
APMIS : acta pathologica, microbiologica, et immunologica Scandinavica 2007 Dec;115(12):1331-43
APMIS : acta pathologica, microbiologica, et immunologica Scandinavica 2007 Dec;115(12):1331-43
No comments: Submit comment
No validations: Submit validation data