HPA020920

WNT2 antibody from Sigma-Aldrich
INT1L1, IRP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020920
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020920, RRID:AB_1858850
Product name
Anti-WNT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020920
Antibody type
Polyclonal
Antigen
Protein Wnt-2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMN
QDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDR
EAGSLGTAGRVCNL
Storage
-20C
Provider Type Product Number
- No reagents -