HPA024377

IKZF3 antibody from Sigma-Aldrich
Aiolos, ZNFN1A3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024377
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024377, RRID:AB_1859477
Product name
Anti-IKZF3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024377
Antibody type
Polyclonal
Antigen
Zinc finger protein Aiolos recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSM
KVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREY
NEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCI
SFNVL
Storage
-20C
Provider Type Product Number
- No reagents -