Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB30015 - Provider product page

- Provider
- Abnova Corporation
- Product name
- CTPS polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against synthetic peptide of human CTPS.
- Antigen sequence
SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTG
EQKTKPTQNSVRELR- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of Capan-1 cell lysate with CTPS polyclonal antibody (Cat # PAB30015) at 1:1000 dilution.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of 721 B lymphoblast cell lysate with CTPS polyclonal antibody (Cat # PAB30015) at 5 ug/mL working concentration.