HPA048086

CSF3R antibody from Atlas Antibodies
CD114, GCSFR
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA048086
Provider
Atlas Antibodies
Product name
Anti-CSF3R
Provider product page
Atlas Antibodies - HPA048086
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TPVVFSESRGPALTRLHAMARDPHSLWVGWEPPNP
WPQGYVIEWGLGPPSASNSNKTWRMEQNGRATGFL
LKENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQE
MAPSHAPELHLKHIGKTWA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -