SAB1401091

CSF3R antibody from Sigma-Aldrich
CD114, GCSFR
No application information provided.

Antibody data

Product number
SAB1401091
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401091, RRID:AB_10609798
Product name
Anti-CSF3R antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB1401091
Antibody type
Polyclonal
Antigen
CSF3R (NP_000751.1, 1 a.a. ~ 836 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MARLGNCSLTWAALIILLLPGSLEECGHISVSAPI
VHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQ
PGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNW
GNSLQILDQVELRAGYPPAIPHNLSCLMNLTTSSL
ICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSIL
DCVPKDGQSHCCIPRKHLLLYQNMGIWVQAENALG
TSMSPQLCLDPMDVVKLEPPMLRTMDPSPEAAPPQ
AGCLQLCWEP
Storage
-20C
Provider Type Product Number
- No reagents -