HPA002548

HUWE1 antibody from Atlas Antibodies
Ib772, KIAA0312, UREB1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002548
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002548, RRID:AB_1080489
Product name
Anti-HUWE1
Provider product page
Atlas Antibodies - HPA002548
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYP
GNRQPNPPLILQRLLGPSAAADILQLSSSLPLQSR
GRARLLVGNDDVHIIARSDDELLDDFFHDQSTATS
QAGTLSSIPTALTRWTEECKVLDAESMHDCVSVVK
VSIVNHLE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -