HPA002548

HUWE1 antibody from Atlas Antibodies
Ib772, KIAA0312, UREB1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002548
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002548, RRID:AB_611872
Product name
Anti-HUWE1
Provider product page
Atlas Antibodies - HPA002548
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYP
GNRQPNPPLILQRLLGPSAAADILQLSSSLPLQSR
GRARLLVGNDDVHIIARSDDELLDDFFHDQSTATS
QAGTLSSIPTALTRWTEECKVLDAESMHDCVSVVK
VSIVNHLE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -