HPA002548

HUWE1 antibody from Sigma-Aldrich
Ib772, KIAA0312, UREB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002548
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002548, RRID:AB_1080489
Product name
Anti-HUWE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002548
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase HUWE1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYP
GNRQPNPPLILQRLLGPSAAADILQLSSSLPLQSR
GRARLLVGNDDVHIIARSDDELLDDFFHDQSTATS
QAGTLSSIPTALTRWTEECKVLDAESMHDCVSVVK
VSIVNHLE
Storage
-20C
Provider Type Product Number
- No reagents -