Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182536 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Inhibitor of DNA Binding 3, Dominant Negative Helix-Loop-Helix Protein (ID3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ID3 antibody: synthetic peptide directed towards the N terminal of human ID3
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAE
EPLSL LDDMNHCYSR- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Targeting Id1 and Id3 inhibits peritoneal metastasis of gastric cancer.
Tsuchiya T, Okaji Y, Tsuno NH, Sakurai D, Tsuchiya N, Kawai K, Yazawa K, Asakage M, Yamada J, Yoneyama S, Kitayama J, Osada T, Watanabe T, Tokunaga K, Takahashi K, Nagawa H
Cancer science 2005 Nov;96(11):784-90
Cancer science 2005 Nov;96(11):784-90
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting