Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021873 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021873, RRID:AB_1854055
- Product name
- Anti-MOG
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVV
HLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTL
RIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDP
FYWVSPG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Early and extensive alterations of glial connexins, distal oligodendrogliopathy type demyelination, and nodal/paranodal pathology are characteristic of multiple system atrophy
Nishimura Y, Masaki K, Matsuse D, Yamaguchi H, Tanaka T, Matsuo E, Hayashida S, Watanabe M, Matsushita T, Sadashima S, Sasagasako N, Yamasaki R, Isobe N, Iwaki T, Kira J
Brain Pathology 2022;33(3)
Brain Pathology 2022;33(3)
No comments: Submit comment
No validations: Submit validation data