HPA019463

PRCC antibody from Sigma-Aldrich
RCCP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019463
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019463, RRID:AB_1855672
Product name
Anti-PRCC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019463
Antibody type
Polyclonal
Antigen
Proline-rich protein PRCC recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RNRGREEINFVEIKGDDQLSGAQQWMTKSLTEEKT
MKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELE
LKNTWSENKLSRRQTQAKY
Storage
-20C
Provider Type Product Number
- No reagents -