HPA019849

RAB27B antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019849
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019849, RRID:AB_1856000
Product name
Anti-RAB27B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019849
Antibody type
Polyclonal
Antigen
Ras-related protein Rab-27B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQI
PDTVNGGNSGNLDGEKPPEKKCIC
Storage
-20C
Provider Type Product Number
- No reagents -