HPA019693

LSP1 antibody from MilliporeSigma / Merck KGaA
WP34
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019693
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019693, RRID:AB_1853387
Product name
Anti-LSP1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019693
Antibody type
Polyclonal
Antigen
Lymphocyte-specific protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNR
SIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAG
RTPKLARQASIELPSMAVASTK
Storage
-20C
Provider Type Product Number
- No reagents -