HPA025821

RECQL4 antibody from Sigma-Aldrich
RecQ4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025821
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025821, RRID:AB_1856168
Product name
Anti-RECQL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025821
Antibody type
Polyclonal
Antigen
ATP-dependent DNA helicase Q4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WLQRCHSEVPDFLGAPKACRPDLGSEESQLLIPGE
SAVLGPGAGSQGPEASAFQEVSIRVGSPQPSSSGG
EKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAV
EEDPPGE
Storage
-20C
Provider Type Product Number
- No reagents -