H00002305-M04

FOXM1 antibody from Abnova Corporation
FKHL16, HFH-11, HNF-3, INS-1, MPHOSPH2, MPP2, TGT3, trident

Antibody data

Product number
H00002305-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002305-M04, RRID:AB_1204370
Product name
FOXM1 monoclonal antibody (M04), clone 4G3
Provider product page
Abnova Corporation - H00002305-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant FOXM1.
Antigen sequence
NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSC
KFPAGIKIINHPTMPNTQVVAIPNNANIHSIITAL
TAKGKESGSSGPNKFILIS
Isotype
IgG
Antibody clone number
4G3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -