ABIN501829
antibody from antibodies-online
Targeting: FOXM1
FKHL16, HFH-11, HNF-3, INS-1, MPHOSPH2, MPP2, TGT3, trident
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501829 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Forkhead Box M1 (FOXM1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the middle region of human FOXM1
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPL
GPDNI NWSQFIPELQ- Vial size
- 50 µg
Submitted references LXRα-mediated downregulation of FOXM1 suppresses the proliferation of hepatocellular carcinoma cells.
Activation of FoxM1 during G2 requires cyclin A/Cdk-dependent relief of autorepression by the FoxM1 N-terminal domain.
Hu C, Liu D, Zhang Y, Lou G, Huang G, Chen B, Shen X, Gao M, Gong W, Zhou P, Dai S, Zeng Y, He F
Oncogene 2014 May 29;33(22):2888-97
Oncogene 2014 May 29;33(22):2888-97
Activation of FoxM1 during G2 requires cyclin A/Cdk-dependent relief of autorepression by the FoxM1 N-terminal domain.
Laoukili J, Alvarez M, Meijer LA, Stahl M, Mohammed S, Kleij L, Heck AJ, Medema RH
Molecular and cellular biology 2008 May;28(9):3076-87
Molecular and cellular biology 2008 May;28(9):3076-87
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting