HPA001879

TAF7L antibody from Atlas Antibodies
CT40, TAF2Q
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001879
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001879, RRID:AB_1857751
Product name
Anti-TAF7L
Provider product page
Atlas Antibodies - HPA001879
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ESQDEVPDEVENQFILRLPLEHACTVRNLARSQSV
KMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPC
VIESLRTLDKKTFYKTADISQMLVCTADGDIHLSP
EEPAASTDPNIVRKKERGREEKCVWKHGITPPLKN
VRK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -