HPA001879

TAF7L antibody from Atlas Antibodies
CT40, TAF2Q
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001879
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001879, RRID:AB_1235825
Product name
Anti-TAF7L
Provider product page
Atlas Antibodies - HPA001879
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ESQDEVPDEVENQFILRLPLEHACTVRNLARSQSV
KMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPC
VIESLRTLDKKTFYKTADISQMLVCTADGDIHLSP
EEPAASTDPNIVRKKERGREEKCVWKHGITPPLKN
VRK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -