HPA001879

TAF7L antibody from Sigma-Aldrich
CT40, TAF2Q
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001879
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001879, RRID:AB_1857751
Product name
Anti-TAF7L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001879
Antibody type
Polyclonal
Antigen
Transcription initiation factor TFIID subunit 7-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESQDEVPDEVENQFILRLPLEHACTVRNLARSQSV
KMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPC
VIESLRTLDKKTFYKTADISQMLVCTADGDIHLSP
EEPAASTDPNIVRKKERGREEKCVWKHGITPPLKN
VRK
Storage
-20C
Provider Type Product Number
- No reagents -