Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA10S - Provider product page

- Provider
- ReliaTech GmbH
- Product name
- Anti-human EGF
- Antibody type
- Polyclonal
- Antigen
- Other
- Description
- antibody Protein-A purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCV
VGYIGERCQYRDLKWWELR- Vial size
- 100 µg
- Storage
- The lyophilized antibody is stable at room temperature for up to 1 month. The reconstituted antibody is stable for at least two weeks at 2-8 °C. Frozen aliquots are stable for at least 6 months when stored at -20 °C.
- Handling
- The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Immunofluorescence staining of human foreskin (cryo-section of PFA-fixed tissue) with anti-human EGF (green; 5µg/ml). Nuclei counter-stained with Dapi (blue). Specimen provided by Prof. Dr. J. Wilting and Dr. K. Buttler, Goettingen. The experiment was performed by the research group of Prof. Dr. J. Wilting, University Göttingen, Germany.
- Sample type
- cryo-sections of human foreskin