Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502124 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Epidermal Growth Factor (EGF) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQ
NDVGH PFAVAVFEDY- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic polymorphism in EGF is associated with prostate cancer aggressiveness and progression-free interval in androgen blockade-treated patients.
Teixeira AL, Ribeiro R, Cardoso D, Pinto D, Lobo F, Fraga A, Pina F, Calais-da-Silva F, Medeiros R
Clinical cancer research : an official journal of the American Association for Cancer Research 2008 Jun 1;14(11):3367-71
Clinical cancer research : an official journal of the American Association for Cancer Research 2008 Jun 1;14(11):3367-71
No comments: Submit comment
No validations: Submit validation data