HPA025226

GGH antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025226
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025226, RRID:AB_1849645
Product name
Anti-GGH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025226
Antibody type
Polyclonal
Antigen
Gamma-glutamyl hydrolase Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTV
DVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLT
ANFHKWSLSVKNFTMNEKLKK
Storage
-20C
Provider Type Product Number
- No reagents -