HPA002803

SERPINA7 antibody from Atlas Antibodies
TBG
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002803
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002803, RRID:AB_1079915
Product name
Anti-SERPINA7
Provider product page
Atlas Antibodies - HPA002803
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YSKNALALFVLPKEGQMESVEAAMSSKTLKKWNRL
LQKGWVDLFVPKFSISATYDLGATLLKMGIQHAYS
ENADFSGLTEDNGLKLSNAAHKAVLHIGEKGTEAA
AVPEVELSDQPENTFLHPIIQIDRSFMLLILERST
RSILFLGKVV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -