H00000657-M01

BMPR1A antibody from Abnova Corporation
ACVRLK3, ALK3, CD292

Antibody data

Product number
H00000657-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000657-M01, RRID:AB_1571119
Product name
BMPR1A monoclonal antibody (M01), clone 4C4
Provider product page
Abnova Corporation - H00000657-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant BMPR1A.
Antigen sequence
MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGM
KSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDD
AINNTCITNGHCFAIIEEDDQGETTLASGCMKYEG
SGFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPP
VVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFC
YKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLV
DQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRY
GEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQT
VLMRHENILGFIAADIKGTGSWTQLYLITDYHENG
SLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIY
GTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAV
KFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQL
PYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSD
ECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMV
ESQDVKI
Isotype
IgG
Antibody clone number
4C4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -